PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco002729.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family MIKC_MADS
Protein Properties Length: 299aa    MW: 33321.3 Da    PI: 9.7367
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco002729.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF86.41.6e-2783132251
                  ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
       SRF-TF   2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                  +i+n++ rqvtfskRr g++KKAeELS+LCdaeva+i+fsstg+l+ +ss
  Aco002729.1  83 KIDNTTARQVTFSKRRRGLFKKAEELSILCDAEVALIVFSSTGRLFHFSS 132
                  69**********************************************96 PP

2K-box49.51.8e-17153243898
        K-box   8 sleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                  ++ + + +  + ++a L k++ +   ++R++ GedLe L+++eLq Le++Le +l ++ + K+  ++eqi++l+kk  +l een++Lr+++
  Aco002729.1 153 DQPTLDLNMEDSNYASLSKQVAETSLQLRQMRGEDLEGLTVEELQLLEKKLEGGLHRVLDMKEAKIMEQISDLRKKGLDLVEENTRLRHQM 243
                  45555666778899**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006630.20774134IPR002100Transcription factor, MADS-box
SMARTSM004322.8E-3874133IPR002100Transcription factor, MADS-box
CDDcd002653.30E-3975150No hitNo description
PROSITE patternPS00350076130IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-267696IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.4E-3076148IPR002100Transcription factor, MADS-box
PfamPF003199.4E-2683130IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-2696111IPR002100Transcription factor, MADS-box
PRINTSPR004043.1E-26111132IPR002100Transcription factor, MADS-box
PROSITE profilePS5129712.69159249IPR002487Transcription factor, K-box
PfamPF014868.5E-17163243IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009908Biological Processflower development
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
GAKGIVIERE RATLLLGLAI KRGASSTPST LTLFLSPPQS HPIVLLLHFL RNPLDQRSTR  60
RRRRGEGIII ITIMAREKIQ IRKIDNTTAR QVTFSKRRRG LFKKAEELSI LCDAEVALIV  120
FSSTGRLFHF SSSSMKEIIK RHSMHSKNLQ KSDQPTLDLN MEDSNYASLS KQVAETSLQL  180
RQMRGEDLEG LTVEELQLLE KKLEGGLHRV LDMKEAKIME QISDLRKKGL DLVEENTRLR  240
HQMLQVSGVG INHSENALAE DGLSAESVMT ASQSGGSLDY DDSSDTSLKL GLACCSWK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-1974147174Myocyte-specific enhancer factor 2B
1tqe_Q2e-1974147174Myocyte-specific enhancer factor 2B
1tqe_R2e-1974147174Myocyte-specific enhancer factor 2B
1tqe_S2e-1974147174Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM6609551e-175KM660955.1 Ananas bracteatus clone 40252 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010942684.11e-113PREDICTED: MADS-box protein SVP-like
RefseqXP_010942683.11e-113PREDICTED: MADS-box protein SVP-like
SwissprotQ9XJ665e-92MAD22_ORYSJ; MADS-box transcription factor 22
TrEMBLQ2NNB91e-101Q2NNB9_ELAGV; MADS box transcription factor
STRINGSb04g033930.19e-97(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12213697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.15e-72MIKC_MADS family protein